O2AT4_HUMAN A6NND4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:A6NND4
Recommended name：Olfactory receptor 2AT4
EC number：
Alternative names：(Olfactory receptor OR11-265)
Cleaved into：
GeneID：341152
Gene names (primary )：OR2AT4
Gene names (synonym )：
Gene names (ORF )：
Length：320
Mass：35503
Sequence：MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALILVAVVAEPSLHKPMYFFLINLSTLDILFTTTTVPKMLSLFLLGDRFLSFSSCLLQMYLFQSFTCSEAFILVVMAYDRYVAICHPLHYPVLMNPQTNATLAASAWLTALLLPIPAVVRTSQMAYNSIAYIYHCFCDHLAVVQASCSDTTPQTLMGFCIAMVVSFLPLLLVLLSYVHILASVLRISSLEGRAKAFSTCSSHLLVVGTYYSSIAIAYVAYRADLPLDFHIMGNVVYAILTPILNPLIYTLRNRDVKAAITKIMSQDPGCDRSI
Tissue specificity：Detected in the keratinocytes of the epidermis (at protein level) (PubMed:24999593). Detected in hair follicles in proximal outer root sheath and hair matrix keratinocytes (at protein level) (PubMed:30228264). {ECO:0000269|PubMed:24999593, ECO:0000269|PubMed:30228264}.
Induction：Down-regulated during spontaneous, apoptosis-driven hair follicles regression (catagen). {ECO:0000269|PubMed:30228264}.
Developmental stage：
Protein families：G-protein coupled receptor 1 family