CSC2A_HUMAN Q6XLA1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6XLA1
Recommended name：Protein CASC2, isoform 3
EC number：
Alternative names：(Cancer susceptibility candidate gene 2 protein, isoform 3)
Cleaved into：
GeneID：
Gene names (primary )：CASC2
Gene names (synonym )：C10orf5
Gene names (ORF )：
Length：102
Mass：11902
Sequence：MTQEKMYPHLFSERCANQHQHRTAEEKKYVSEKQLIHWRCEEPSAHHNSIDIKRMKHFGSALRLRQTFHLDTADHPCVITMNPALPWKLEGSNSTSTLPLPA
Tissue specificity：Expressed in normal and neoplastic endometrial tissues. {ECO:0000269|PubMed:15024726}.
Induction：Down-regulated in endometrial and colorectal tumor samples. {ECO:0000269|PubMed:15024726, ECO:0000269|PubMed:17352238}.
Developmental stage：
Protein families：