PSCA_HUMAN   O43653


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O43653

Recommended name:Prostate stem cell antigen

EC number:

Alternative names:

Cleaved into:

GeneID:8000

Gene names  (primary ):PSCA

Gene names  (synonym ):

Gene names  (ORF ):UNQ206/PRO232

Length:114

Mass:11959

Sequence:MAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL

Tissue specificity:Highly expressed in prostate (basal, secretory and neuroendocrine epithelium cells). Also found in bladder (transitional epithelium), placenta (trophoblasts), stomach (neuroendocrine cells), colon (neuroendocrine cells) and kidney (collecting ducts). Overexpressed in prostate cancers and expression is correlated with tumor stage, grade and androgen-independence. Highly expressed in prostate cancer bone metastases. Expressed in gastric epithelial cells, mainly in the isthmus (at protein level). Not detected in normal intestinal epithelium (at protein level). Expressed in brain cortex; expression is significantly increased in the front cortex of Alzheimer disease patients. {ECO:0000269|PubMed:10713670, ECO:0000269|PubMed:18488030, ECO:0000269|PubMed:25680266}.

Induction:Down-regulated in gastric cancer cells. {ECO:0000269|PubMed:18488030}.

Developmental stage:

Protein families:


   💬 WhatsApp