MZB1_HUMAN Q8WU39
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8WU39
Recommended name：Marginal zone B- and B1-cell-specific protein
EC number：
Alternative names：(Mesenteric estrogen-dependent adipose 7) (MEDA-7) (Plasma cell-induced resident endoplasmic reticulum protein) (Plasma cell-induced resident ER protein) (pERp1) (Proapoptotic caspase adapter protein)
Cleaved into：
GeneID：51237
Gene names (primary )：MZB1
Gene names (synonym )：MEDA7 PACAP
Gene names (ORF )：HSPC190
Length：189
Mass：20694
Sequence：MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREEL
Tissue specificity：Widely expressed with highest levels in adult brain, small intestine and lymphoid tissues such as thymus and spleen. Expression is frequently lower in intestinal-type gastric cancer. In obese patients, more abundant in omental than in subcutaneous fat. {ECO:0000269|PubMed:11350957, ECO:0000269|PubMed:12792799, ECO:0000269|PubMed:19805157}.
Induction：Down-regulated in primary B-cells early after ligand-stimulated activation. Up-regulated in bacterial lipopolysaccharides (LPS)-stimulated peritoneal macrophages. {ECO:0000269|PubMed:11350957, ECO:0000269|PubMed:21688198}.
Developmental stage：
Protein families：MZB1 family