FBSP1_HUMAN P0C2W1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P0C2W1
Recommended name：F-box/SPRY domain-containing protein 1
EC number：
Alternative names：(F-box only protein 45) (hFbxo45)
Cleaved into：
GeneID：200933
Gene names (primary )：FBXO45
Gene names (synonym )：FBX45
Gene names (ORF )：
Length：286
Mass：30633
Sequence：MAAPAPGAGAASGGAGCSGGGAGAGAGSGSGAAGAGGRLPSRVLELVFSYLELSELRSCALVCKHWYRCLHGDENSEVWRSLCARSLAEEALRTDILCNLPSYKAKIRAFQHAFSTNDCSRNVYIKKNGFTLHRNPIAQSTDGARTKIGFSEGRHAWEVWWEGPLGTVAVIGIATKRAPMQCQGYVALLGSDDQSWGWNLVDNNLLHNGEVNGSFPQCNNAPKYQIGERIRVILDMEDKTLAFERGYEFLGVAFRGLPKVCLYPAVSAVYGNTEVTLVYLGKPLDG
Tissue specificity：
Induction：Down-regulated in response to DNA-damage. {ECO:0000269|PubMed:19581926}.
Developmental stage：
Protein families：FBXO45/Fsn family