NPC2_HUMAN P61916
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P61916
Recommended name：NPC intracellular cholesterol transporter 2
EC number：
Alternative names：(Epididymal secretory protein E1) (Human epididymis-specific protein 1) (He1) (Niemann-Pick disease type C2 protein)
Cleaved into：
GeneID：10577
Gene names (primary )：NPC2
Gene names (synonym )：HE1
Gene names (ORF )：
Length：151
Mass：16570
Sequence：MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL
Tissue specificity：Detected in gallbladder bile (PubMed:21315718). Detected in fibroblasts, kidney, liver, spleen, small intestine, placenta and testis (at protein level) (PubMed:11125141). Epididymis. {ECO:0000269|PubMed:11125141, ECO:0000269|PubMed:19664597, ECO:0000269|PubMed:21315718}.
Induction：Down-regulated in response to enterovirus 71 (EV71) infection. {ECO:0000269|PubMed:16548883}.
Developmental stage：
Protein families：NPC2 family