SLPI_HUMAN P03973
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P03973
Recommended name:Antileukoproteinase
EC number:
Alternative names:(ALP) (BLPI) (HUSI-1) (Mucus proteinase inhibitor) (MPI) (Protease inhibitor WAP4) (Secretory leukocyte protease inhibitor) (Seminal proteinase inhibitor) (WAP four-disulfide core domain protein 4)
Cleaved into:
GeneID:6590
Gene names (primary ):SLPI
Gene names (synonym ):WAP4 WFDC4
Gene names (ORF ):
Length:132
Mass:14326
Sequence:MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA
Tissue specificity:Detected in blood plasma (PubMed:24352879). Detected in bone marrow myeloid cells (PubMed:24352879). Detected in airway sputum (PubMed:2039600). Detected in parotid gland secretions (PubMed:3462719). Detected in seminal plasma (at protein level) (PubMed:3485543). Detected in uterus cervix (PubMed:3533531). {ECO:0000269|PubMed:2039600, ECO:0000269|PubMed:24352879, ECO:0000269|PubMed:3462719, ECO:0000269|PubMed:3485543, ECO:0000269|PubMed:3533531}.
Induction:Down-regulated in response to low ELANE activity. Up-regulated by ELANE treatment in bone marrow cells. {ECO:0000269|PubMed:24352879}.
Developmental stage:
Protein families: