NSUN5_HUMAN   Q96P11


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96P11

Recommended name:28S rRNA (cytosine-C(5))-methyltransferase

EC number:EC:2.1.1.-

Alternative names:(NOL1-related protein) (NOL1R) (NOL1/NOP2/Sun domain family member 5) (Williams-Beuren syndrome chromosomal region 20A protein)

Cleaved into:

GeneID:55695

Gene names  (primary ):NSUN5

Gene names  (synonym ):NSUN5A WBSCR20 WBSCR20A

Gene names  (ORF ):

Length:429

Mass:46692

Sequence:MGLYAAAAGVLAGVESRQGSIKGLVYSSNFQNVKQLYALVCETQRYSAVLDAVIASAGLLRAEKKLRPHLAKVLVYELLLGKGFRGGGGRWKALLGRHQARLKAELARLKVHRGVSRNEDLLEVGSRPGPASQLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSDPRYHEVHYILLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSTCSLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVAVIERVEVPR

Tissue specificity:Ubiquitous (PubMed:11978965, PubMed:12073013). Detected in placenta, heart and skeletal muscle (PubMed:11978965, PubMed:12073013). {ECO:0000269|PubMed:11978965, ECO:0000269|PubMed:12073013}.

Induction:Down-regulated in some glioma; epigenetic inactivation is a hallmark of glioma patients with long-term survival. {ECO:0000269|PubMed:31428936}.

Developmental stage:

Protein families:Class I-like SAM-binding methyltransferase superfamily, RsmB/NOP family


   💬 WhatsApp