FA30A_HUMAN Q9NZY2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NZY2
Recommended name：Putative uncharacterized protein FAM30A
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：FAM30A
Gene names (synonym )：C14orf110 KIAA0125
Gene names (ORF )：HSPC053
Length：134
Mass：14626
Sequence：MGTLQGAALRSRERPSWPQETHGHRERTEEGCAVAAFSADALRTGGQELEQTGLRPKAGAPPMPDLLGHRICTDIGKGWRMDGGRTCSCSSFCRCPERGARRSSPDAPGLALDFPLLLDLLWHLCSWTSQPLEL
Tissue specificity：
Induction：Down-regulated when the beta-APP42/beta-APP40 ratio is high, which is typical of Alzheimer's disease. {ECO:0000269|PubMed:19707560}.
Developmental stage：
Protein families：