SPR2D_HUMAN   P22532


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P22532

Recommended name:Small proline-rich protein 2D

EC number:

Alternative names:(SPR-2D) (Small proline-rich protein II) (SPR-II)

Cleaved into:

GeneID:6703

Gene names  (primary ):SPRR2D

Gene names  (synonym ):

Gene names  (ORF ):

Length:72

Mass:7905

Sequence:MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPSPPCQPKCPPKSK

Tissue specificity:

Induction:During squamous differentiation of epidermal keratinocytes.

Developmental stage:

Protein families:Cornifin (SPRR) family


   💬 WhatsApp