SPRR3_HUMAN Q9UBC9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9UBC9
Recommended name：Small proline-rich protein 3
EC number：
Alternative names：(22 kDa pancornulin) (Cornifin beta) (Esophagin)
Cleaved into：
GeneID：6707
Gene names (primary )：SPRR3
Gene names (synonym )：SPRC
Gene names (ORF )：
Length：169
Mass：18154
Sequence：MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQK
Tissue specificity：
Induction：During squamous differentiation of epidermal keratinocytes.
Developmental stage：
Protein families：Cornifin (SPRR) family