SPR1A_HUMAN P35321
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P35321
Recommended name：Cornifin-A
EC number：
Alternative names：(19 kDa pancornulin) (SPRK) (Small proline-rich protein IA) (SPR-IA)
Cleaved into：
GeneID：6698
Gene names (primary )：SPRR1A
Gene names (synonym )：
Gene names (ORF )：
Length：89
Mass：9877
Sequence：MNSQQQKQPCTPPPQPQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCQPKVPEPCPSTVTPAPAQQKTKQK
Tissue specificity：
Induction：During squamous differentiation of epidermal keratinocytes.
Developmental stage：
Protein families：Cornifin (SPRR) family