HEPC_HUMAN P81172
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P81172
Recommended name：Hepcidin
EC number：
Alternative names：(Liver-expressed antimicrobial peptide 1) (LEAP-1) (Putative liver tumor regressor) (PLTR)
Cleaved into：Hepcidin-25 (Hepc25); Hepcidin-20 (Hepc20)
GeneID：57817
Gene names (primary )：HAMP
Gene names (synonym )：HEPC LEAP1
Gene names (ORF )：UNQ487/PRO1003
Length：84
Mass：9408
Sequence：MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT
Tissue specificity：Highest expression in liver and to a lesser extent in heart and brain. Low levels in lung, tonsils, salivary gland, trachea, prostate gland, adrenal gland and thyroid gland. Secreted into the urine and blood (PubMed:11034317). Expressed by hepatocytes (PubMed:15124018). {ECO:0000269|PubMed:11034317, ECO:0000269|PubMed:15124018}.
Induction：Expression in hepatocytes is induced by LPS stimulus and the induction is mediated by IL6 (PubMed:15124018). Expression is inhibited in presence of TNF (PubMed:15124018). {ECO:0000269|PubMed:15124018}.
Developmental stage：
Protein families：Hepcidin family