IL32_HUMAN P24001
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P24001
Recommended name：Interleukin-32
EC number：
Alternative names：(IL-32) (Natural killer cells protein 4) (Tumor necrosis factor alpha-inducing factor)
Cleaved into：
GeneID：9235
Gene names (primary )：IL32
Gene names (synonym )：NK4 TAIF
Gene names (ORF )：
Length：234
Mass：26676
Sequence：MCFPKVLSDDMKKLKARMVMLLPTSAQGLGAWVSACDTEDTVGHLGPWRDKDPALWCQLCLSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK
Tissue specificity：Selectively expressed in lymphocytes. Expression is more prominent in immune cells than in non-immune cells. {ECO:0000269|PubMed:15664165}.
Induction：Expression increased after activation of T-cells by mitogens or activation of NK cells by IL2/interleukin-2. {ECO:0000269|PubMed:1729377}.
Developmental stage：
Protein families：