DCNL5_HUMAN Q9BTE7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BTE7
Recommended name:DCN1-like protein 5
EC number:
Alternative names:(DCNL5) (DCUN1 domain-containing protein 5) (Defective in cullin neddylation protein 1-like protein 5) (Squamous cell carcinoma-related oncogene 5)
Cleaved into:
GeneID:84259
Gene names (primary ):DCUN1D5
Gene names (synonym ):SCCRO5
Gene names (ORF ):
Length:237
Mass:27508
Sequence:MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWFYEYAGPDEVVGPEGMEKFCEDIGVEPENIIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEKLQNKFDFLRSQLNDISSFKNIYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHADLSNYDEDGAWPVLLDEFVEWQKVRQTS
Tissue specificity:Weakly expressed in testis, skin and immune tissues (thymus, spleen and lymph nodes). {ECO:0000269|PubMed:26906416}.
Induction:Expression is decreased in a time-dependent manner after UVC exposure. {ECO:0000269|PubMed:23098533}.
Developmental stage:
Protein families: