FGL1_HUMAN Q08830
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q08830
Recommended name：Fibrinogen-like protein 1
EC number：
Alternative names：(HP-041) (Hepassocin) (HPS) (Hepatocyte-derived fibrinogen-related protein 1) (HFREP-1) (Liver fibrinogen-related protein 1) (LFIRE-1)
Cleaved into：
GeneID：2267
Gene names (primary )：FGL1
Gene names (synonym )：HFREP1
Gene names (ORF )：
Length：312
Mass：36379
Sequence：MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
Tissue specificity：Under normal conditions, liver-specific. {ECO:0000269|PubMed:11470158}.
Induction：Expression is induced by interleukin-6 (IL6) (PubMed:18039467). Up-regulated in a number of cancers, such as lung cancer, prostate cancer, melanoma and colorectal cancer (PubMed:30580966). {ECO:0000269|PubMed:18039467, ECO:0000269|PubMed:30580966}.
Developmental stage：
Protein families：