ATG12_HUMAN O94817
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O94817
Recommended name：Ubiquitin-like protein ATG12
EC number：
Alternative names：(Autophagy-related protein 12) (APG12-like)
Cleaved into：
GeneID：9140
Gene names (primary )：ATG12
Gene names (synonym )：APG12 APG12L
Gene names (ORF )：
Length：140
Mass：15113
Sequence：MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG
Tissue specificity：Ubiquitous. {ECO:0000269|PubMed:9852036}.
Induction：Expression is induced by mitochondrial DNA deletions, chloramphenicol and nicotinamide. {ECO:0000269|PubMed:17457038, ECO:0000269|PubMed:19473119}.
Developmental stage：
Protein families：ATG12 family