CD24_HUMAN P25063
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P25063
Recommended name：Signal transducer CD24
EC number：
Alternative names：(Small cell lung carcinoma cluster 4 antigen) (CD antigen CD24)
Cleaved into：
GeneID：100133941
Gene names (primary )：CD24
Gene names (synonym )：CD24A
Gene names (ORF )：
Length：80
Mass：8083
Sequence：MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
Tissue specificity：B-cells. Expressed in a number of B-cell lines including P32/ISH and Namalwa. Expressed in erythroleukemia cell and small cell lung carcinoma cell lines. Also expressed on the surface of T-cells. {ECO:0000269|PubMed:14657362, ECO:0000269|PubMed:8753773}.
Induction：Expression is lost when primary B-cells are induced to differentiate in antibody-forming cells.
Developmental stage：
Protein families：CD24 family