MTFP1_HUMAN   Q9UDX5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UDX5

Recommended name:Mitochondrial fission process protein 1

EC number:

Alternative names:(Mitochondrial 18 kDa protein) (MTP18)

Cleaved into:

GeneID:51537

Gene names  (primary ):MTFP1

Gene names  (synonym ):MTP18

Gene names  (ORF ):HSPC242 My022

Length:166

Mass:18010

Sequence:MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS

Tissue specificity:

Induction:Expression is regulated by the phosphatidylinositol (PI) 3-kinase pathway. {ECO:0000269|PubMed:15155745}.

Developmental stage:

Protein families:MTFP1 family


   💬 WhatsApp