ANGL7_HUMAN O43827
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O43827
Recommended name：Angiopoietin-related protein 7
EC number：
Alternative names：(Angiopoietin-like factor) (Angiopoietin-like protein 7) (Cornea-derived transcript 6 protein)
Cleaved into：
GeneID：10218
Gene names (primary )：ANGPTL7
Gene names (synonym )：CDT6
Gene names (ORF )：UNQ313/PRO356
Length：346
Mass：40018
Sequence：MLKKPLSAVTWLCIFIVAFVSHPAWLQKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP
Tissue specificity：Higly expressed in the cornea (at protein level) (PubMed:11682471). Expression is restricted to the stromal layer (PubMed:11682471). Also detected at the junction between the corneal stromal layer and the conjuctiva. Not detected in the sclera (PubMed:11682471). {ECO:0000269|PubMed:11682471, ECO:0000269|PubMed:9727400}.
Induction：Expression is up-regulated by dexamethasone. {ECO:0000269|PubMed:16541013}.
Developmental stage：
Protein families：