MK12_HUMAN P53778
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P53778
Recommended name:Mitogen-activated protein kinase 12
EC number:EC:2.7.11.24
Alternative names:(MAP kinase 12) (MAPK 12) (Extracellular signal-regulated kinase 6) (ERK-6) (Mitogen-activated protein kinase p38 gamma) (MAP kinase p38 gamma) (Stress-activated protein kinase 3)
Cleaved into:
GeneID:6300
Gene names (primary ):MAPK12
Gene names (synonym ):ERK6 SAPK3
Gene names (ORF ):
Length:367
Mass:41940
Sequence:MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL
Tissue specificity:Highly expressed in skeletal muscle and heart. {ECO:0000269|PubMed:11991731, ECO:0000269|PubMed:8633070}.
Induction:Expression of MAPK12 is down-regulation by MAPK14 activation. {ECO:0000269|PubMed:17724032}.
Developmental stage:
Protein families:Protein kinase superfamily, CMGC Ser/Thr protein kinase family, MAP kinase subfamily