NRARP_HUMAN   Q7Z6K4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7Z6K4

Recommended name:Notch-regulated ankyrin repeat-containing protein

EC number:

Alternative names:

Cleaved into:

GeneID:441478

Gene names  (primary ):NRARP

Gene names  (synonym ):

Gene names  (ORF ):

Length:114

Mass:12492

Sequence:MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGR

Tissue specificity:

Induction:In endothelial cells by Notch signaling. {ECO:0000269|PubMed:19154719}.

Developmental stage:

Protein families:NRARP family


   💬 WhatsApp