CNR2_HUMAN   P34972


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P34972

Recommended name:Cannabinoid receptor 2

EC number:

Alternative names:(CB-2) (CB2) (hCB2) (CX5)

Cleaved into:

GeneID:1269

Gene names  (primary ):CNR2

Gene names  (synonym ):CB2A CB2B

Gene names  (ORF ):

Length:360

Mass:39681

Sequence:MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Tissue specificity:Preferentially expressed in cells of the immune system with higher expression in B-cells and NK cells (at protein level). Expressed in skin in suprabasal layers and hair follicles (at protein level). Highly expressed in tonsil and to a lower extent in spleen, peripheral blood mononuclear cells, and thymus. PubMed:14657172 could not detect expression in normal brain. Expressed in brain by perivascular microglial cells and dorsal root ganglion sensory neurons (at protein level). Two isoforms are produced by alternative promoter usage and differ only in the 5' UTR: isoform CB2A is observed predominantly in testis with some expression in brain, while isoform CB2B is predominant in spleen and leukocytes. {ECO:0000269|PubMed:12153574, ECO:0000269|PubMed:12511587, ECO:0000269|PubMed:14657172, ECO:0000269|PubMed:15266552, ECO:0000269|PubMed:18692962, ECO:0000269|PubMed:19496827, ECO:0000269|PubMed:7556170}.

Induction:In macrophages, down-regulated by endocannabinoid anandamide/AEA. {ECO:0000269|PubMed:23955712}.

Developmental stage:

Protein families:G-protein coupled receptor 1 family


   💬 WhatsApp