APLD1_HUMAN Q96LR9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96LR9
Recommended name：Apolipoprotein L domain-containing protein 1
EC number：
Alternative names：(Vascular early response gene protein)
Cleaved into：
GeneID：81575
Gene names (primary )：APOLD1
Gene names (synonym )：VERGE
Gene names (ORF )：
Length：279
Mass：30546
Sequence：MFRAPCHRLRARGTRKARAGAWRGCTFPCLGKGMERPAAREPHGPDALRRFQGLLLDRRGRLHGQVLRLREVARRLERLRRRSLVANVAGSSLSATGALAAIVGLSLSPVTLGTSLLVSAVGLGVATAGGAVTITSDLSLIFCNSRELRRVQEIAATCQDQMREILSCLEFFCRWQGCGDRQLLQCGRNASIALYNSVYFIVFFGSRGFLIPRRAEGDTKVSQAVLKAKIQKLAESLESCTGALDELSEQLESRVQLCTKSSRGHDLKISADQRAGLFF
Tissue specificity：Expressed in neonatal dermal microvascular endothelial cells. {ECO:0000269|PubMed:15102925}.
Induction：In neonatal dermal microvascular endothelial cells, by hypoxia. {ECO:0000269|PubMed:15102925}.
Developmental stage：
Protein families：Apolipoprotein L family