GTR8_HUMAN Q9NY64
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NY64
Recommended name：Solute carrier family 2, facilitated glucose transporter member 8
EC number：
Alternative names：(Glucose transporter type 8) (GLUT-8) (Glucose transporter type X1)
Cleaved into：
GeneID：29988
Gene names (primary )：SLC2A8
Gene names (synonym )：GLUT8 GLUTX1
Gene names (ORF )：
Length：477
Mass：50819
Sequence：MTPEDPEETQPLLGPPGGSAPRGRRVFLAAFAAALGPLSFGFALGYSSPAIPSLQRAAPPAPRLDDAAASWFGAVVTLGAAAGGVLGGWLVDRAGRKLSLLLCSVPFVAGFAVITAAQDVWMLLGGRLLTGLACGVASLVAPVYISEIAYPAVRGLLGSCVQLMVVVGILLAYLAGWVLEWRWLAVLGCVPPSLMLLLMCFMPETPRFLLTQHRRQEAMAALRFLWGSEQGWEDPPIGAEQSFHLALLRQPGIYKPFIIGVSLMAFQQLSGVNAVMFYAETIFEEAKFKDSSLASVVVGVIQVLFTAVAALIMDRAGRRLLLVLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPVDASVGLAWLAVGSMCLFIAGFAVGWGPIPWLLMSEIFPLHVKGVATGICVLTNWLMAFLVTKEFSSLMEVLRPYGAFWLASAFCIFSVLFTLFCVPETKGKTLEQITAHFEGR
Tissue specificity：Highly expressed in testis, but not in testicular carcinoma. Lower amounts present in most other tissues. {ECO:0000269|PubMed:10821868}.
Induction：In testis, down-regulated by estrogen. {ECO:0000269|PubMed:10821868}.
Developmental stage：
Protein families：Major facilitator superfamily, Sugar transporter (TC 2.A.1.1) family, Glucose transporter subfamily