CHAC1_HUMAN Q9BUX1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BUX1
Recommended name：Glutathione-specific gamma-glutamylcyclotransferase 1
EC number：EC:4.3.2.7
Alternative names：(Gamma-GCG 1) (Blocks Notch protein) (Botch) (Cation transport regulator-like protein 1)
Cleaved into：
GeneID：79094
Gene names (primary )：CHAC1
Gene names (synonym )：BOTCH
Gene names (ORF )：
Length：222
Mass：24418
Sequence：MKQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKALAYVATPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTMLPCFCPTEQALALV
Tissue specificity：
Induction：Induced by chemical activators of the unfolded protein response (UPR) such as tunicamycin, DTT and thapsigargin. {ECO:0000269|PubMed:19109178}.
Developmental stage：
Protein families：Gamma-glutamylcyclotransferase family, ChaC subfamily