ZNHI1_HUMAN O43257
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O43257
Recommended name：Zinc finger HIT domain-containing protein 1
EC number：
Alternative names：(Cyclin-G1-binding protein 1) (Zinc finger protein subfamily 4A member 1) (p18 Hamlet)
Cleaved into：
GeneID：10467
Gene names (primary )：ZNHIT1
Gene names (synonym )：CGBP1 ZNFN4A1
Gene names (ORF )：
Length：154
Mass：17536
Sequence：MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV
Tissue specificity：Expressed abundantly in liver, but weakly in skeletal muscle, ovary and small intestine. {ECO:0000269|PubMed:17892483}.
Induction：Induced by DNA damage. {ECO:0000269|PubMed:17380123}.
Developmental stage：
Protein families：ZNHIT1 family