SIR4_HUMAN Q9Y6E7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Y6E7
Recommended name：NAD-dependent protein lipoamidase sirtuin-4, mitochondrial
EC number：EC:2.3.1.-
Alternative names：(NAD-dependent ADP-ribosyltransferase sirtuin-4) (NAD-dependent protein deacetylase sirtuin-4) (Regulatory protein SIR2 homolog 4) (SIR2-like protein 4)
Cleaved into：
GeneID：23409
Gene names (primary )：SIRT4
Gene names (synonym )：SIR2L4
Gene names (ORF )：
Length：314
Mass：35188
Sequence：MKMSFALTFRSAKGRWIANPSQPCSKASIGLFVPASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYARTDRRPIQHGDFVRSAPIRQRYWARNFVGWPQFSSHQPNPAHWALSTWEKLGKLYWLVTQNVDALHTKAGSRRLTELHGCMDRVLCLDCGEQTPRGVLQERFQVLNPTWSAEAHGLAPDGDVFLSEEQVRSFQVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQVYSGYRFILTAWEKKLPIAILNIGPTRSDDLACLKLNSRCGELLPLIDPC
Tissue specificity：Detected in vascular smooth muscle and striated muscle. Detected in insulin-producing beta-cells in pancreas islets of Langerhans (at protein level). Widely expressed. Weakly expressed in leukocytes and fetal thymus. {ECO:0000269|PubMed:10381378}.
Induction：Induced by glutamine (at protein level). {ECO:0000269|PubMed:25525879}.
Developmental stage：
Protein families：Sirtuin family, Class II subfamily