OPN3_HUMAN Q9H1Y3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9H1Y3
Recommended name：Opsin-3
EC number：
Alternative names：(Encephalopsin) (Panopsin)
Cleaved into：
GeneID：23596
Gene names (primary )：OPN3
Gene names (synonym )：ECPN
Gene names (ORF )：
Length：402
Mass：44873
Sequence：MYSGNRSGGHGYWDGGGAAGAEGPAPAGTLSPAPLFSPGTYERLALLLGSIGLLGVGNNLLVLVLYYKFQRLRTPTHLLLVNISLSDLLVSLFGVTFTFVSCLRNGWVWDTVGCVWDGFSGSLFGIVSIATLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILDVHGLGCTVDWKSKDANDSSFVLFLFLGCLVVPLGVIAHCYGHILYSIRMLRCVEDLQTIQVIKILKYEKKLAKMCFLMIFTFLVCWMPYIVICFLVVNGHGHLVTPTISIVSYLFAKSNTVYNPVIYVFMIRKFRRSLLQLLCLRLLRCQRPAKDLPAAGSEMQIRPIVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQVRPL
Tissue specificity：Expressed in tracheal airway smooth muscle (at protein level) (PubMed:30284927). Expressed throughout the epidermis and dermis, predominantly in the basal layer on the facial and abdominal skin (at protein level) (PubMed:30168605). Expressed in dermal fibroblasts (at protein level) (PubMed:31380578). Expressed in melanocytes (at protein level) (PubMed:28842328, PubMed:31097585, PubMed:31730232). Expressed in keratinocytes (PubMed:28842328). Expressed in the retina (PubMed:30284927). {ECO:0000269|PubMed:28842328, ECO:0000269|PubMed:30168605, ECO:0000269|PubMed:30284927, ECO:0000269|PubMed:31097585, ECO:0000269|PubMed:31380578, ECO:0000269|PubMed:31730232}.
Induction：Induced by low-level blue light (453nm) during epithelial wound healing (PubMed:30168605). Induced by ultraviolet A light in dermal fibroblasts (PubMed:31380578). {ECO:0000269|PubMed:30168605, ECO:0000269|PubMed:31380578}.
Developmental stage：
Protein families：G-protein coupled receptor 1 family, Opsin subfamily