TCIM_HUMAN Q9NR00
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NR00
Recommended name：Transcriptional and immune response regulator
EC number：
Alternative names：(Thyroid cancer protein 1) (TC-1)
Cleaved into：
GeneID：56892
Gene names (primary )：TCIM
Gene names (synonym )：C8orf4 TC1
Gene names (ORF )：
Length：106
Mass：12337
Sequence：MKAKRSHQAVIMSTSLRVSPSIHGYHFDTASRKKAVGNIFENTDQESLERLFRNSGDKKAEERAKIIFAIDQDVEEKTRALMALKKRTKDKLFQFLKLRKYSIKVH
Tissue specificity：Ubiquitous. Expressed in thyroid papillary carcinoma. Expressed in liver, expression levels decrease in hepatocellular carcinoma (PubMed:25985737). Slightly detected in normal lung, its expression is highly induced in lung cancer cells (at protein level) (PubMed:24941347). {ECO:0000269|PubMed:11056052, ECO:0000269|PubMed:24941347, ECO:0000269|PubMed:25985737}.
Induction：Induced by proinflammatory cytokines such as TNF and IL1B, via NF-kappaB signaling (PubMed:16730711, PubMed:19684084). Induced by cellular stresses such as heat shock, TPA, lipopolysaccharide and UV (PubMed:17603013). Induced by mitogens such as thrombin (PubMed:18959821). {ECO:0000269|PubMed:16730711, ECO:0000269|PubMed:17603013, ECO:0000269|PubMed:18959821, ECO:0000269|PubMed:19684084}.
Developmental stage：
Protein families：