LEP_HUMAN P41159
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P41159
Recommended name：Leptin
EC number：
Alternative names：(Obese protein) (Obesity factor)
Cleaved into：
GeneID：3952
Gene names (primary )：LEP
Gene names (synonym )：OB OBS
Gene names (ORF )：
Length：167
Mass：18641
Sequence：MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Tissue specificity：Adipose tissue is the main source of leptin. It is also produced by other peripheral tissues such as the skeletal muscle (PubMed:7789654, PubMed:16052473, PubMed:12448771). Expressed by intercalated and striated tracts of submandibular and parotid salivary gland intralobular ducts (PubMed:12448771). Detected by fundic epithelium of the gastric mucosa (PubMed:10896907). Secreted into blood and gastric juice (PubMed:10896907). {ECO:0000269|PubMed:10896907, ECO:0000269|PubMed:12448771, ECO:0000269|PubMed:16052473, ECO:0000269|PubMed:7789654}.
Induction：Induced by secretin. {ECO:0000269|PubMed:10896907}.
Developmental stage：
Protein families：Leptin family