DERM_HUMAN   Q07507


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q07507

Recommended name:Dermatopontin

EC number:

Alternative names:(Tyrosine-rich acidic matrix protein) (TRAMP)

Cleaved into:

GeneID:1805

Gene names  (primary ):DPT

Gene names  (synonym ):

Gene names  (ORF ):

Length:201

Mass:24005

Sequence:MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV

Tissue specificity:Expressed in fibroblasts, heart, skeletal muscle, brain and pancreas. Expressed at an intermediate level in lung and kidney, and at a low level in liver and placenta. Expressed at a lower level in fibroblasts from hypertrophic scar lesional skin and in fibroblasts from patients with systemic sclerosis than in normal skin fibroblasts. {ECO:0000269|PubMed:10233760, ECO:0000269|PubMed:8104875}.

Induction:Induced by TGFB1, repressed by IL4/interleukin-4. {ECO:0000269|PubMed:10233760}.

Developmental stage:

Protein families:Dermatopontin family


   💬 WhatsApp