PTGES_HUMAN O14684
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O14684
Recommended name：Prostaglandin E synthase
EC number：EC:5.3.99.3
Alternative names：(Glutathione peroxidase PTGES) (Glutathione transferase PTGES) (Microsomal glutathione S-transferase 1-like 1) (MGST1-L1) (Microsomal prostaglandin E synthase 1) (MPGES-1) (p53-induced gene 12 protein)
Cleaved into：
GeneID：9536
Gene names (primary )：PTGES
Gene names (synonym )：MGST1L1 MPGES1 PGES PIG12
Gene names (ORF )：
Length：152
Mass：17102
Sequence：MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Tissue specificity：
Induction：Induced by the interleukin IL1B (PubMed:10377395, PubMed:10760517). Induced By p53/TP53 (PubMed:9305847). {ECO:0000269|PubMed:10377395, ECO:0000269|PubMed:10760517, ECO:0000269|PubMed:9305847}.
Developmental stage：
Protein families：MAPEG family