SNAI1_HUMAN O95863
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O95863
Recommended name：Zinc finger protein SNAI1
EC number：
Alternative names：(Protein snail homolog 1) (Protein sna)
Cleaved into：
GeneID：6615
Gene names (primary )：SNAI1
Gene names (synonym )：SNAH
Gene names (ORF )：
Length：264
Mass：29083
Sequence：MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR
Tissue specificity：Expressed in a variety of tissues with the highest expression in kidney. Expressed in mesenchymal and epithelial cell lines. {ECO:0000269|PubMed:10655587}.
Induction：Induced by TPA maximally by 2.5-fold at 4 hours, in HepG2 cells (at protein level). {ECO:0000269|PubMed:20121949}.
Developmental stage：
Protein families：Snail C2H2-type zinc-finger protein family