SHSA5_HUMAN   Q8N114


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8N114

Recommended name:Protein shisa-5

EC number:

Alternative names:(Putative NF-kappa-B-activating protein 120) (Scotin)

Cleaved into:

GeneID:51246

Gene names  (primary ):SHISA5

Gene names  (synonym ):SCOTIN

Gene names  (ORF ):PSEC0133

Length:240

Mass:25582

Sequence:MTAPVPAPRILLPLLLLLLLTPPPGARGEVCMASRGLSLFPESCPDFCCGTCDDQYCCSDVLKKFVWSEERCAVPEASVPASVEPVEQLGSALRFRPGYNDPMSGFGATLAVGLTIFVLSVVTIIICFTCSCCCLYKTCRRPRPVVTTTTSTTVVHAPYPQPPSVPPSYPGPSYQGYHTMPPQPGMPAAPYPMQYPPPYPAQPMGPPAYHETLAGGAAAPYPASQPPYNPAYMDAPKAAL

Tissue specificity:

Induction:Induced in a p53/TP53-dependent manner in response to cellular stress. {ECO:0000269|PubMed:12135983}.

Developmental stage:

Protein families:Shisa family


   💬 WhatsApp