IL17_HUMAN Q16552
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q16552
Recommended name：Interleukin-17A
EC number：
Alternative names：(IL-17) (IL-17A) (Cytotoxic T-lymphocyte-associated antigen 8) (CTLA-8)
Cleaved into：
GeneID：3605
Gene names (primary )：IL17A
Gene names (synonym )：CTLA8 IL17
Gene names (ORF )：
Length：155
Mass：17504
Sequence：MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Tissue specificity：Expressed in memory Th17 cells (at protein level). {ECO:0000269|PubMed:17763419}.
Induction：Induced upon differentiation of CD4-positive T cells. Up-regulated by IL23A-IL12B (PubMed:17763419). Up-regulated in peripheral blood mononuclear cells upon West Nile virus infection (PubMed:27795421). {ECO:0000269|PubMed:17763419, ECO:0000269|PubMed:27795421}.
Developmental stage：
Protein families：IL-17 family