T150B_HUMAN A6NC51
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:A6NC51
Recommended name：Modulator of macroautophagy TMEM150B
EC number：
Alternative names：(Protein DRAM-3) (Transmembrane protein 150B) (Transmembrane protein 224)
Cleaved into：
GeneID：284417
Gene names (primary )：TMEM150B
Gene names (synonym )：TMEM224
Gene names (ORF )：
Length：233
Mass：25701
Sequence：MWGYLSLMPVFLAVWAISGVWIVFAIAVTNRTVDLSKGFPYISICGSFPPQSCIFSQVLNMGAALAAWICIVRYHQLRDWGVRRWPNQLILWTGLLCALGTSVVGNFQEKNQRPTHLAGAFLAFILGNVYFWLQLLLWRLKRLPQPGAAWIGPLRLGLCSVCTILIVAMIVLHACSLRSVSAACEWVVAMLLFALFGLLAVDFSALESCTLCVQPWPSLSPPPASPISLPVQL
Tissue specificity：Highly expressed in the colon and lung with comparatively high levels also detectable in the lymph nodes, placenta, duodenum, peripheral blood mononuclear cells and spleen (PubMed:25929859). {ECO:0000269|PubMed:25929859}.
Induction：Is not markedly up- or down-regulated by DNA damage, nutrient deprivation or by exposure to TNF-alpha and IFN-gamma (PubMed:25929859). {ECO:0000269|PubMed:25929859}.
Developmental stage：
Protein families：DRAM/TMEM150 family