FABP6_HUMAN P51161
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P51161
Recommended name：Gastrotropin
EC number：
Alternative names：(GT) (Fatty acid-binding protein 6) (Ileal lipid-binding protein) (ILBP) (Intestinal 15 kDa protein) (I-15P) (Intestinal bile acid-binding protein) (I-BABP)
Cleaved into：
GeneID：2172
Gene names (primary )：FABP6
Gene names (synonym )：ILBP ILLBP
Gene names (ORF )：
Length：128
Mass：14371
Sequence：MAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
Tissue specificity：Isoform 1 is expressed in the jejunum, ileum, cecum and ascending colon intestine. Isoform 2 is xpressed in the gallbladder, duodenum, jejunum, ileum, cecum, ascending, transverse and descending colon, sigmoid colon and rectum. Isoform 2 is expressed in colorectal adenocarcinomas and their adjacent normal mucosa (at protein level). {ECO:0000269|PubMed:17909007, ECO:0000269|PubMed:7588781, ECO:0000269|PubMed:7619861}.
Induction：Isoform 1 is up-regulated by chenodeoxycholic acid (CDCA) via the FXR transcription pathway. Isoform 2 is up-regulated by NF-kappa-B and in all stages of colorectal adenocarcinoma. Isoform 1 is not up-regulated in all stages of colorectal adenocarcinoma. {ECO:0000269|PubMed:17909007}.
Developmental stage：
Protein families：Calycin superfamily, Fatty-acid binding protein (FABP) family