SIAH1_HUMAN Q8IUQ4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8IUQ4
Recommended name：E3 ubiquitin-protein ligase SIAH1
EC number：EC:2.3.2.27
Alternative names：(RING-type E3 ubiquitin transferase SIAH1) (Seven in absentia homolog 1) (Siah-1) (Siah-1a)
Cleaved into：
GeneID：6477
Gene names (primary )：SIAH1
Gene names (synonym )：HUMSIAH
Gene names (ORF )：
Length：282
Mass：31123
Sequence：MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Tissue specificity：Widely expressed at a low level. Down-regulated in advanced hepatocellular carcinomas. {ECO:0000269|PubMed:12557228, ECO:0000269|PubMed:9403064}.
Induction：May be induced by p53/TP53, suggesting that it may be required to modulate p53/TP53 response. The relevance of such activity in vivo is however unclear and may not exist.
Developmental stage：
Protein families：SINA (Seven in absentia) family