DRAM2_HUMAN Q6UX65
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6UX65
Recommended name：DNA damage-regulated autophagy modulator protein 2
EC number：
Alternative names：(Transmembrane protein 77)
Cleaved into：
GeneID：128338
Gene names (primary )：DRAM2
Gene names (synonym )：TMEM77
Gene names (ORF )：PSEC0031 UNQ154/PRO180
Length：266
Mass：29766
Sequence：MWWFQQGLSFLPSALVIWTSAAFIFSYITAVTLHHIDPALPYISDTGTVAPEKCLFGAMLNIAAVLCIATIYVRYKQVHALSPEENVIIKLNKAGLVLGILSCLGLSIVANFQKTTLFAAHVSGAVLTFGMGSLYMFVQTILSYQMQPKIHGKQVFWIRLLLVIWCGVSALSMLTCSSVLHSGNFGTDLEQKLHWNPEDKGYVLHMITTAAEWSMSFSFFGFFLTYIRDFQKISLRVEANLHGLTLYDTAPCPINNERTRLLSRDI
Tissue specificity：Expression is down-regulated in ovarian tumors (at protein level). Widely expressed with highest levels in placenta and heart. Expressed in the retina. Not detected in brain or thymus. {ECO:0000269|PubMed:19556885, ECO:0000269|PubMed:19895784, ECO:0000269|PubMed:25983245}.
Induction：Not induced by p53/TP53 or TP73/p73. {ECO:0000269|PubMed:19556885}.
Developmental stage：
Protein families：DRAM/TMEM150 family