IRGM_HUMAN A1A4Y4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:A1A4Y4
Recommended name：Immunity-related GTPase family M protein
EC number：EC:3.6.5.-
Alternative names：(Immunity-related GTPase family M protein 1) (Interferon-inducible protein 1) (LPS-stimulated RAW 264.7 macrophage protein 47 homolog) (LRG-47)
Cleaved into：
GeneID：345611
Gene names (primary )：IRGM
Gene names (synonym )：IFI1 IRGM1 LRG47
Gene names (ORF )：
Length：181
Mass：20142
Sequence：MEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY
Tissue specificity：Widely expressed (at protein level). Expressed in several tissues including colon, small bowel and peripheral blood leukocytes. {ECO:0000269|PubMed:16888103, ECO:0000269|PubMed:17554261}.
Induction：Not up-regulated by IFNG/IFN-gamma. {ECO:0000269|PubMed:16277747}.
Developmental stage：
Protein families：TRAFAC class dynamin-like GTPase superfamily, IRG family