IL6_HUMAN P05231
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P05231
Recommended name：Interleukin-6
EC number：
Alternative names：(IL-6) (B-cell stimulatory factor 2) (BSF-2) (CTL differentiation factor) (CDF) (Hybridoma growth factor) (Interferon beta-2) (IFN-beta-2)
Cleaved into：
GeneID：3569
Gene names (primary )：IL6
Gene names (synonym )：IFNB2
Gene names (ORF )：
Length：212
Mass：23718
Sequence：MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Tissue specificity：Produced by skeletal muscle. {ECO:0000269|PubMed:11080265}.
Induction：Plasma levels are highly increased upon exercise, due to enhanced production by contracting skeletal muscles. {ECO:0000269|PubMed:11080265}.
Developmental stage：
Protein families：IL-6 superfamily