OSTB_HUMAN Q86UW2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q86UW2
Recommended name：Organic solute transporter subunit beta
EC number：
Alternative names：(OST-beta) (Solute carrier family 51 subunit beta)
Cleaved into：
GeneID：123264
Gene names (primary )：SLC51B
Gene names (synonym )：OSTB
Gene names (ORF )：
Length：128
Mass：14346
Sequence：MEHSEGAPGDPAGTVVPQELLEEMLWFFRVEDASPWNHSILALAAVVVIISMVLLGRSIQASRKEKMQPPEKETPEVLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETES
Tissue specificity：Widely expressed with a high expression in ileum. Expressed in testis, colon, liver, small intestine, kidney, ovary and adrenal gland; and at low levels in heart, lung, brain, pituitary, thyroid gland, uterus, prostate, mammary gland and fat. {ECO:0000269|PubMed:12719432, ECO:0000269|PubMed:16317684}.
Induction：Positively regulated via NR1H4/FXR. {ECO:0000269|PubMed:16251721, ECO:0000269|PubMed:16269519}.
Developmental stage：
Protein families：OST-beta family