NOL3_HUMAN O60936
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O60936
Recommended name:Nucleolar protein 3
EC number:
Alternative names:(Apoptosis repressor with CARD) (Muscle-enriched cytoplasmic protein) (Myp) (Nucleolar protein of 30 kDa) (Nop30)
Cleaved into:
GeneID:8996
Gene names (primary ):NOL3
Gene names (synonym ):ARC NOP
Gene names (ORF ):
Length:208
Mass:22629
Sequence:MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS
Tissue specificity:Highly expressed in heart and skeletal muscle. Detected at low levels in placenta, liver, kidney and pancreas.
Induction:Protein expression decreases in hearts failure patients (PubMed:16505176) and in response to oxidative stress (PubMed:17142452). {ECO:0000269|PubMed:16505176, ECO:0000269|PubMed:17142452}.
Developmental stage:
Protein families: