JTB_HUMAN O76095
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O76095
Recommended name：Protein JTB
EC number：
Alternative names：(Jumping translocation breakpoint protein) (Prostate androgen-regulated protein) (PAR protein)
Cleaved into：
GeneID：10899
Gene names (primary )：JTB
Gene names (synonym )：
Gene names (ORF )：HSPC222
Length：146
Mass：16358
Sequence：MLAGAGRPGLPQGRHLCWLLCAFTLKLCQAEAPVQEEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRLFWKFEGAVVCVALIFACLVIIRQRQLDRKALEKVRKQIESI
Tissue specificity：Ubiquitous. Expressed in all normal human tissues studied but overexpressed or underexpressed in many of their malignant counterparts. {ECO:0000269|PubMed:10321732, ECO:0000269|PubMed:10762645, ECO:0000269|PubMed:17369841, ECO:0000269|PubMed:21225229}.
Induction：Protein levels increase during the S phase of the cell cycle, are highest during G2 and mitosis, and decrease to low levels at G1. Levels are lowest at the transition from G1 to S phase. {ECO:0000269|PubMed:21225229}.
Developmental stage：
Protein families：JTB family