SLUR1_HUMAN P55000
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P55000
Recommended name：Secreted Ly-6/uPAR-related protein 1
EC number：
Alternative names：(SLURP-1) (ARS component B) (ARS(component B)-81/S) (Anti-neoplastic urinary protein) (ANUP)
Cleaved into：
GeneID：57152
Gene names (primary )：SLURP1
Gene names (synonym )：ARS
Gene names (ORF )：
Length：103
Mass：11186
Sequence：MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
Tissue specificity：Granulocytes. Expressed in skin. Predominantly expressed in the granular layer of skin, notably the acrosyringium. Identified in several biological fluids such as sweat, saliva, tears, plasma and urine. {ECO:0000269|PubMed:14721776, ECO:0000269|PubMed:17008884}.
Induction：Regulated by retinoic acid, EGF and IFNG/IFN-gamma (PubMed:14721776). Down-regulated by IL-13 in cultured human bronchial epithelial cells (related to asthmatic condition) (PubMed:20621062). {ECO:0000269|PubMed:14721776, ECO:0000269|PubMed:20621062}.
Developmental stage：
Protein families：