LFG2_HUMAN Q9BWQ8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BWQ8
Recommended name：Protein lifeguard 2
EC number：
Alternative names：(Fas apoptotic inhibitory molecule 2) (Neural membrane protein 35) (Transmembrane BAX inhibitor motif-containing protein 2)
Cleaved into：
GeneID：23017
Gene names (primary )：FAIM2
Gene names (synonym )：KIAA0950 LFG LFG2 NMP35 TMBIM2
Gene names (ORF )：
Length：316
Mass：35110
Sequence：MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLMGNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE
Tissue specificity：Highly expressed in breast carcinoma tissues. Enhanced expression correlates with the grade of the tumor (grade II/grade III) in primary breast tumors (at protein level). Widely expressed. Expressed at high levels in the brain especially in the hippocampus. {ECO:0000269|PubMed:10535980, ECO:0000269|PubMed:20336406}.
Induction：Regulated by the AKT1/LEF1 pathway in breast cancer cell lines. {ECO:0000269|PubMed:20336373}.
Developmental stage：
Protein families：BI1 family, LFG subfamily