IMPA2_HUMAN   O14732


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O14732

Recommended name:Inositol monophosphatase 2

EC number:EC:3.1.3.25

Alternative names:(IMP 2) (IMPase 2) (Inositol-1(or 4)-monophosphatase 2) (Myo-inositol monophosphatase A2)

Cleaved into:

GeneID:3613

Gene names  (primary ):IMPA2

Gene names  (synonym ):IMP.18P

Gene names  (ORF ):

Length:288

Mass:31321

Sequence:MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK

Tissue specificity:

Induction:Repressed by Li(+).

Developmental stage:

Protein families:Inositol monophosphatase superfamily


   💬 WhatsApp