PSF1_HUMAN   Q14691


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q14691

Recommended name:DNA replication complex GINS protein PSF1

EC number:

Alternative names:(GINS complex subunit 1)

Cleaved into:

GeneID:9837

Gene names  (primary ):GINS1

Gene names  (synonym ):KIAA0186 PSF1

Gene names  (ORF ):

Length:196

Mass:22988

Sequence:MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSVLPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS

Tissue specificity:

Induction:Significantly up-regulated in aggressive melanomas. {ECO:0000269|PubMed:17611626}.

Developmental stage:

Protein families:GINS1/PSF1 family


   💬 WhatsApp