THAP5_HUMAN Q7Z6K1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7Z6K1
Recommended name:THAP domain-containing protein 5
EC number:
Alternative names:
Cleaved into:
GeneID:168451
Gene names (primary ):THAP5
Gene names (synonym ):
Gene names (ORF ):
Length:395
Mass:45416
Sequence:MPRYCAAICCKNRRGRNNKDRKLSFYPFPLHDKERLEKWLKNMKRDSWVPSKYQFLCSDHFTPDSLDIRWGIRYLKQTAVPTIFSLPEDNQGKDPSKKKSQKKNLEDEKEVCPKAKSEESFVLNETKKNIVNTDVPHQHPELLHSSSLVKPPAPKTGSIQNNMLTLNLVKQHTGKPESTLETSVNQDTGRGGFHTCFENLNSTTITLTTSNSESIHQSLETQEVLEVTTSHLANPNFTSNSMEIKSAQENPFLFSTINQTVEELNTNKESVIAIFVPAENSKPSVNSFISAQKETTEMEDTDIEDSLYKDVDYGTEVLQIEHSYCRQDINKEHLWQKVSKLHSKITLLELKEQQTLGRLKSLEALIRQLKQENWLSEENVKIIENHFTTYEVTMI
Tissue specificity:Detected in heart (PubMed:19502560, PubMed:21195082). Detected in brain and muscle (at protein level) (PubMed:19502560). Highly expressed in the heart. Also found in brain and skeletal muscle (PubMed:19502560, PubMed:21195082). {ECO:0000269|PubMed:19502560, ECO:0000269|PubMed:21195082}.
Induction:Up-regulated both in response to UV light treatment and cisplatin, agents that cause DNA damage (at protein level). {ECO:0000269|PubMed:21110952}.
Developmental stage:
Protein families: